No products in the cart.
IGF-1 LR3 0.1 mg (1 vial)
Roll over image to zoom in
฿873
IGF-1 LR3 allows for a number of growth-promoting effects of the growth hormone-insulin-like growth factors otherwise known as IGF. It comprises a family of peptides that play important roles in growth and development of mammals. The long R3 IGF-1 version is importantly more potent than regular IGF-1. Its improved potency is due to the decreased binding of IGF-1 LR3 to all known IGF binding proteins.
The strongest impact IGF has on the human body is its capacity to cause hyperplasia. In muscle cells, proteins and their cell parts are stimulated. Protein combination is expanded along with amino acid absorption. As a source of energy, IGF-1 activates fat. In lean tissue, IGF keeps insulin from moving glucose across cell layers.
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Other Names: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
Total Amount of the Active Ingredient: 0.1 mg (1 vial)
Top Color: Green
Shelf Life: 36 months
Minimum Order: 1 vial
Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.
Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.
IGF-1 LR3 0.1 mg should be reconstituted with bacteriostatic water (BAC).
You can purchase BAC water here:
BAC 10ml
BAC 20ml
Click here to buy 10 vials (1 kit) at a discounted price!
Shipping:
•USA
•Canada
•International
•Europe
•South Asia: (Afghanistan, Bangladesh, Bhutan, India, Maldives, Nepal, Pakistan, Sri Lanka)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey)
If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.
Product Quality Guarantee
All of our products are lab tested and the results are occasionally published on the website.
You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
- Cost of HPLC test
- Total amount of the order shipping fee
Additional information
Weight | 1 kg |
---|
Reviews
There are no reviews yet.