IGF-1 DES 1 mg KIT (10 vials), 10 mg

IGF-1 DES is a splice variant of IGF-1 that can be isolated from bovine colostrum, porcine uterus, and human brain. It is estimated to be 10-fold more potent than IGF-1 at stimulating hypertrophy and inducing cultured cells proliferation.

Clinical evaluations have shown its potential application in catabolic states and in the management of inflammatory bowel diseases.

Other Names: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molar Mass: 7,372 Da

Total Amount of the Active Ingredient: 10 mg

Concentration: 1 mg per vial

Top Color: Green/Yellow

Shelf Life: 36 months

Minimum Order: 1 kit (10 vials) / price is per kit

Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.

Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.

IGF-1 DES 1 mg should be reconstituted with bacteriostatic water (BAC).

You can purchase BAC water here:
BAC 10ml 
BAC 20ml 

Just click here to purchase just 1-9 vials!

Shipping: 
•USA
•Canada
•International
•Europe
•South Asia: (Afghanistan, Bangladesh, Bhutan, India, Maldives, Nepal, Pakistan, Sri Lanka)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey)

Enjoy these shipping rates for up to 10 kits!

If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.

Product Quality Guarantee

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:

• Cost of HPLC test
• Total amount of the order shipping fee

Download IGF1 DES HPLC Report

Download IGF1 DES MS Report