IGF-1 LR3 1 mg (1 vial)

฿2,699

88 in stock

SKU: IGF-LR3-1M Category:

IGF-1 LR3 allows for a number of growth-promoting effects of the growth hormone-insulin-like growth factors otherwise known as IGF. It comprises a family of peptides that play important roles in growth and development of mammals. The long R3 IGF-1 version is importantly more potent than regular IGF-1. Its improved potency is due to the decreased binding of IGF-1 LR3 to all known IGF binding proteins. You can take IGF-1 LR3 in injectable, powder, nasal form please take doctor prescription for IGF-1 LR3 dosage.

The strongest impact IGF has on the human body is its capacity to cause hyperplasia. In muscle cells, proteins and their cell parts are stimulated. Protein combination is expanded along with amino acid absorption. As a source of energy, IGF-1 activates fat. In lean tissue, IGF keeps insulin from moving glucose across cell layers.

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Molar Mass: 9,111 Da

Other Names: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

Total Amount of the Active Ingredient: 1 mg (1 vial)

Top Color: Green/Red

Shelf Life: 36 months

Minimum Order: 1 vial

Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.

Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.

Click here to buy 10 vials (1 kit) at a discounted price!

IGF-1 LR3 1 mg has to be reconstituted with bacteriostatic water (BAC).

You can purchase BAC water here:
BAC 10ml 
BAC 20ml 

Shipping
•USA
•Canada
•International
•Europe
•South Asia: (Afghanistan, Bangladesh, Bhutan, India, Maldives, Nepal, Pakistan, Sri Lanka)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey)

If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.


Product Quality Guarantee

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:

  • Cost of HPLC test
  • Total amount of the order shipping fee

Additional information

Weight 1 kg
Be the first to review “IGF-1 LR3 1 mg (1 vial)”

Your email address will not be published. Required fields are marked *

Reviews

There are no reviews yet.

See It Styled On Instagram

    No access token

Main Menu